SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000007113 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000007113
Domain Number 1 Region: 3-71
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000495
Family BphP N-terminal domain-like 0.028
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000007113
Domain Number - Region: 317-408
Classification Level Classification E-value
Superfamily t-snare proteins 0.0549
Family t-snare proteins 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000007113   Gene: ENSCJAG00000003903   Transcript: ENSCJAT00000007512
Sequence length 675
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:X:138567013:138610993:1 gene:ENSCJAG00000003903 transcript:ENSCJAT00000007512 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LDGFMITLSTDGVIIYVDENISPLLGHMPSATVDKKLLSLLPDAEKNKVSEKIILKFPLF
NSETHIEFCCHLKRGNVEHGDGPAYEYVKFILNVKHICNESAVFFSSFCSSRRYAALSAK
HITWEDQFYLMGIVCVLRTQLLKRLYTRSKVTDKFILTQESDEESFVKDLSGSQDEGGHT
SMEVVCAEPITITARDAVMDDQIEITQVEQHGPQDNGNIEDSDSTYCSSTDFMDNIPESS
DLLFLQGFQFEPEVNPLYMAEPVDLEFSVDQEDSVDQRGPMDQQDPENPVDLLGETGLMD
SVDTENSEDLETAGTSAQPLQPLSPVVHSIISQEMDVIKKLKEQLEKRSQMLHDTIQDQQ
DALAVIIDQFQKQPNTSHHVVSPDSQPSEAEPMKQQKQHTGQAERSLPHPKEVKRVCDLS
SCNSFKNTRKLQEPCAAVTQQTLAAKCMAATSIQSNKEAQLLLLFALRKLNSSGTCRHQG
PFISCLLQEQPQKRNVIVGNHMLQICLQNPSCVTGPLGNNPVRFLQTQPIVVPIQIVAEQ
QLSGHQEDESQSSHPKECLELTTSQVPLVDTPNPEAISSSTTTSKSSDSTISTQEVPEDC
IHIWEQLPGPCNQTCNERGTTHCQPIYRQVWCNTLTDIGAEGPPGQQAFQGPAAYQPDQM
RNLTPEEQRDSNKQR
Download sequence
Identical sequences F6S995
ENSCJAP00000007113 ENSCJAP00000042189

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]