SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000007347 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000007347
Domain Number 1 Region: 73-149
Classification Level Classification E-value
Superfamily Translation proteins 6e-18
Family Gar1-like SnoRNP 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000007347   Gene: ENSCJAG00000004041   Transcript: ENSCJAT00000007764
Sequence length 220
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:3:83855964:83865457:-1 gene:ENSCJAG00000004041 transcript:ENSCJAT00000007764 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFRGGGRGGFNRGGGSGGFNRGSSSNHFRGGGGGGGGGGGNFRGGGRGGFGRGGGRGGF
NKGQDQGPPERVVLLGEFLHPCEDDIVCKCTTDENKVPYFNAPVYLENKEQIGKVDEIFG
QLRDFYFSVKLSENMKASSFKKLQKFYIDPYKLLPLQRFLPRPPGEKGPPRGGGRGGRGG
GRGGGGRGGGRGGGFRGGRGGGGGGFRGGRGGGGFRGRGH
Download sequence
Identical sequences F6RKS9
ENSCJAP00000007347 ENSCJAP00000007347 XP_008991102.1.60252 XP_008991103.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]