SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000007662 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCJAP00000007662
Domain Number - Region: 258-299
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.0314
Family Frizzled cysteine-rich domain 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000007662   Gene: ENSCJAG00000004195   Transcript: ENSCJAT00000008100
Sequence length 580
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:X:121440281:121914243:-1 gene:ENSCJAG00000004195 transcript:ENSCJAT00000008100 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGTVCTACLVVAMLLSLDCPGRAQPPPPPPDATCHQVRSFFQRLQPGLKWVPETPVPGS
DLQVCLPKGPTCCSRKMEEKYQLTARLNMEQLLQSASMELKFLIIQNAAVFQESFEIVVR
HAKNYTNAMFKNNYPSLTPQAFEFVGEFFTDVSLYILGSDINVDDMVNELFDSLFPVIYT
QLMNPGLPDSALDINECLRGARRDLKVFGNFPKLIMTQVSKSLQVTRIFLQALNLGIEVI
NTTDHLKFSKDCGRMLTRMWYCSYCQGLMMVKPCGGYCNVVMQGCMAGVVEIDKYWREYI
LSLEELVNGMYRIYDMENILLGLFSTIHDSIQYVQKNAGKLTTTIGKLCAHSQQRQYRSA
YYPEDLFIDKKVLKVAHVEHEETLSSRRRELIQKLKSFISFYSALPGYICSHSPVAENDT
LCWNGQELVERYSQKAARNGMKNQFNLHELKMKGPEPVVSQIIDKLKHINQLLRTMSVPK
GRVLDKNLDEEGFESGDCGDDEDECIGGSGDGMMKVKNQLRFLAELAYDLDVDDAPGSKQ
QVIPKDNEISTSHNLGNAHYPLKLLTSVALSVVCFVFLVD
Download sequence
Identical sequences F6TNP5
ENSCJAP00000007662

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]