SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000007664 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCJAP00000007664
Domain Number - Region: 258-299
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.034
Family Frizzled cysteine-rich domain 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000007664   Gene: ENSCJAG00000004195   Transcript: ENSCJAT00000008102
Sequence length 603
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:X:121440281:121914243:-1 gene:ENSCJAG00000004195 transcript:ENSCJAT00000008102 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGTVCTACLVVAMLLSLDCPGRAQPPPPPPDATCHQVRSFFQRLQPGLKWVPETPVPGS
DLQVCLPKGPTCCSRKMEEKYQLTARLNMEQLLQSASMELKFLIIQNAAVFQESFEIVVR
HAKNYTNAMFKNNYPSLTPQAFEFVGEFFTDVSLYILGSDINVDDMVNELFDSLFPVIYT
QLMNPGLPDSALDINECLRGARRDLKVFGNFPKLIMTQVSKSLQVTRIFLQALNLGIEVI
NTTDHLKFSKDCGRMLTRMWYCSYCQGLMMVKPCGGYCNVVMQGCMAGVVEIDKYWREYI
LSLEELVNGMYRIYDMENILLGLFSTIHDSIQYVQKNAGKLTTTETEKTIWHFKYPIFLL
CIGQELQIGKLCAHSQQRQYRSAYYPEDLFIDKKVLKVAHVEHEETLSSRRRELIQKLKS
FISFYSALPGYICSHSPVAENDTLCWNGQELVERYSQKAARNGMKNQFNLHELKMKGPEP
VVSQIIDKLKHINQLLRTMSVPKGRVLDKNLDEEGFESGDCGDDEDECIGGSGDGMMKVK
NQLRFLAELAYDLDVDDAPGSKQQVIPKDNEISTSHNLGNAHYPLKLLTSVALSVVCFVF
LVD
Download sequence
Identical sequences F6TNJ4
ENSCJAP00000007664 ENSCJAP00000007658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]