SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000007770 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCJAP00000007770
Domain Number - Region: 178-202
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00196
Family CCCH zinc finger 0.0032
Further Details:      
 
Domain Number - Region: 13-42
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00484
Family CCCH zinc finger 0.0036
Further Details:      
 
Domain Number - Region: 213-236
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0824
Family CCCH zinc finger 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000007770   Gene: ENSCJAG00000004294   Transcript: ENSCJAT00000008215
Sequence length 255
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:1:12325476:12499994:1 gene:ENSCJAG00000004294 transcript:ENSCJAT00000008215 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALNVAPVRDTKWLTLEVCRQFQRGTCSRSDEECKFAHPPKSCQVENGRVIACFDSLKGR
CSRENCKYLHPPTHLKTQLEINGRNNLIQQKTAAAMLAQQMQFMFPGTPLHPVPTFPVGP
AIGTNTAISFAPYLAPVTPGVGLVPTEILPTTPVIVPGSPPVTVPGSTATQKLLRTDKLE
VCREFQRGNCARGETDCRFAHPADSTMIDTSDNTVTVCMDYIKGRCMREKCKYFHPPAHL
QAKIKAAQPRPRPQS
Download sequence
Identical sequences A0A2J8M936 F6WY58 O95205
O95205 ENSP00000432422 ENSP00000432422 ENSCJAP00000007770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]