SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000007782 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCJAP00000007782
Domain Number - Region: 178-202
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00327
Family CCCH zinc finger 0.0032
Further Details:      
 
Domain Number - Region: 13-42
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00798
Family CCCH zinc finger 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000007782   Gene: ENSCJAG00000004294   Transcript: ENSCJAT00000008228
Sequence length 361
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:1:12252732:12502104:1 gene:ENSCJAG00000004294 transcript:ENSCJAT00000008228 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALNVAPVRDTKWLTLEVCRQFQRGTCSRSDEECKFAHPPKSCQVENGRVIACFDSLKGR
CSRENCKYLHPPTHLKTQLEINGRNNLIQQKTAAAMLAQQMQFMFPGTPLHPVPTFPVGP
AIGTNTAISFAPYLAPVTPGVGLVPTEILPTTPVIVPGSPPVTVPGSTATQKLLRTDKLE
VCREFQRGNCARGETDCRFAHPADSTMIDTSDNTVTVCMDYIKGRCMREKCKYFHPPAHL
QAKIKAAQHQANQAAVAAQAAAAAATVMAFPPGALHPLPKRQALEKSNGTSAVFNPSVLH
YQQALTSAQLQQHAAFIPTDNSEIISRNGMECQESALRITKHCYCTYYPVSSSIELPQTA
C
Download sequence
Identical sequences A0A2I3HZL2 A0A2J8X8P3 A0A2K5ILC6 A0A2K5S842 A0A2K5YAP6 A0A2K6SJP9 A2A3S3 F7FMK1 H9ELW7 K7DA36
ENSCJAP00000007782 ENSCJAP00000048547 gi|46411180|ref|NP_997187.1| ENSP00000344214 ENSP00000380726 NP_997187.1.87134 NP_997187.1.92137 XP_001141292.1.37143 XP_003832081.1.60992 XP_003928256.1.74449 XP_004088204.1.23891 XP_004088206.1.23891 XP_007958910.1.81039 XP_009247006.1.23681 XP_011732466.1.29376 XP_011732472.1.29376 XP_011789198.1.43180 XP_011826053.1.47321 XP_011890844.1.92194 XP_012314055.1.9421 XP_016875800.1.92137 XP_017385543.1.71028 XP_017825544.1.60252 ENSP00000344214 ENSP00000380726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]