SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000007790 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCJAP00000007790
Domain Number - Region: 13-42
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00424
Family CCCH zinc finger 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000007790   Gene: ENSCJAG00000004294   Transcript: ENSCJAT00000008236
Sequence length 206
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:1:12380559:12499597:1 gene:ENSCJAG00000004294 transcript:ENSCJAT00000008236 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALNVAPVRDTKWLTLEVCRQFQRGTCSRSDEECKFAHPPKSCQVENGRVIACFDSLKGR
CSRENCKYLHPPTHLKTQLEINGRNNLIQQKTAAAMLAQQMQFMFPGTPLHPVAFPPGAL
HPLPKRQALEKSNGTSAVFNPSVLHYQQALTSAQLQQHAAFIPTDNSEIISRNGMECQES
ALRITKHCYCTYYPVSSSIELPQTAC
Download sequence
Identical sequences B4E3F7 F6WDS7
ENSP00000406842 ENSCJAP00000007790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]