SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000008161 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000008161
Domain Number 1 Region: 254-297
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000148
Family RING finger domain, C3HC4 0.02
Further Details:      
 
Domain Number 2 Region: 187-222
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000000196
Family CCCH zinc finger 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000008161   Gene: ENSCJAG00000004501   Transcript: ENSCJAT00000008627
Sequence length 337
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:1:13316059:13317097:-1 gene:ENSCJAG00000004501 transcript:ENSCJAT00000008627 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPSSQGRTADQADQTCTFLLKKSGRKGAAGLRKRPACDPERRDSSSSGDEGDVVARPP
RVAPRPRGLHVWQKAAHCDLRSEEAAPESLGVVYRSTRSAKPVGPEDMGATADFEQDTEK
ERDTQAIFKRSQRLQEALRGREHDQIYRGIHNYPRYLKPKDTSMGNTSSGMAKKGPIRAP
GHLRATVHWDYQPDICKDYKETGFCGFGDSCKFLHDRSDYKHGWQIEQELEEGRYGICED
ENHEVGSEEEEMPFKCFICRQAFQNPVVTKCRHYFCESCALGHFRATPRCYVCDQPTGGI
FNTAKELMAKLQKLRATESGEKSHFTEDPDEGKIPMA
Download sequence
Identical sequences F7ISF4
ENSCJAP00000008161 ENSCJAP00000008161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]