SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000008198 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000008198
Domain Number 1 Region: 90-194
Classification Level Classification E-value
Superfamily DEATH domain 6.24e-24
Family DEATH effector domain, DED 0.0085
Further Details:      
 
Domain Number 2 Region: 5-74
Classification Level Classification E-value
Superfamily DEATH domain 0.00000000471
Family DEATH effector domain, DED 0.015
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000008198
Domain Number - Region: 229-263
Classification Level Classification E-value
Superfamily Caspase-like 0.000179
Family Caspase catalytic domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000008198   Gene: ENSCJAG00000004505   Transcript: ENSCJAT00000008668
Sequence length 300
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:6:116639583:116671354:1 gene:ENSCJAG00000004505 transcript:ENSCJAT00000008668 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAEVIHQVEEALDTDEKEMLLFLCRDVAIDVVPPNVRDLLDILRERGKLSLVSLAELLY
RVRRFDLLKRILKMDRKAVEDHLLRHPHLVSDYRVLMAEIGENLDKSDVSSLIFLMRDYM
GRGKINKEKSFLDLVVELEKRNLVAPDQLDLLEKCLKNIHRLDLKTKIQKYKQSAQGAGT
SYKNVLQAAIKNSFKDPSNNFRLHNGRSKEQRLKEQLGTQQEPVKTSIQESEAFLPQSMP
EERYKMKSKPLGICLIIDCIGNETENVHSWISTLNSIATCMIGTAEFLLRRNTMSGCSTL
Download sequence
Identical sequences F7IMN8
ENSCJAP00000008198 XP_008997452.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]