SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000008249 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000008249
Domain Number 1 Region: 181-393
Classification Level Classification E-value
Superfamily Caspase-like 4.19e-74
Family Caspase catalytic domain 0.00000000771
Further Details:      
 
Domain Number 2 Region: 2-113
Classification Level Classification E-value
Superfamily DEATH domain 4.18e-33
Family DEATH effector domain, DED 0.0034
Further Details:      
 
Domain Number 3 Region: 98-179
Classification Level Classification E-value
Superfamily DEATH domain 4.94e-19
Family DEATH effector domain, DED 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000008249   Gene: ENSCJAG00000004551   Transcript: ENSCJAT00000008721
Sequence length 395
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:6:116782528:116803183:1 gene:ENSCJAG00000004551 transcript:ENSCJAT00000008721 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFSKMLFNIGEELGSEELAALKFLSLDYIPQRKQEPIKDALMLFQRLQEKRMLEESNLF
FLKELLFRINRLDLLNKYLHTSKEEMERELQTPGSAQISAYRVMLYQISEDVSRSELRSF
KFLLKKEISKCKLDDDMNLLDIFIEMEKRVILGEEKLDVLKRVCDQINKSLLKIINDYEE
FSREALSKTFKELHFEIRPYNDCTREEIYEILQSYQRMDHSNKDCFICCILSHGDKGIIY
GTDGHEAPIYELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQKGIPVETDSEEQPYLEMD
LSSPQKRYIPDEADFLLGMATVNNCVSYRNPVEGTWYIQSLCQSLKERCPRGDDILTILT
EVNYEVSNKDDKKNMGKQMPQPTFTLRKKLVFSSD
Download sequence
Identical sequences F7ID68
ENSCJAP00000008249

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]