SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000008507 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000008507
Domain Number 1 Region: 509-573
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000209
Family HLH, helix-loop-helix DNA-binding domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000008507   Gene: ENSCJAG00000004642   Transcript: ENSCJAT00000008996
Sequence length 619
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:22:1303645:1346546:-1 gene:ENSCJAG00000004642 transcript:ENSCJAT00000008996 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNQPQRMAPVGTDKELSDLLDFSMMFPLPVTNGKGRPASLAGAQFGASGLEDRPSSGSWG
SGDQNSSSFDPSRTYSEGAHFTESHSSLSSSTFLGPGLGGKSGERGAYASFGRDAGVGGL
TQAGFLPGELALNSPGPLSPSGMKGTSQYYPSYSSSSRRRAADGGLDAQPKKVRKVPPGL
PSSVYPPSSGEDYGRDAATYPSTKTPSSTYPAPFYMADGSLHPSAELWSPPGQAGFGPML
GGGASPLPLPPGSGPVASGGGSSTFGGLHQHERMGYQLHGAEVNGGLPAASTFSSAPGAA
YGGVSSHTPPVTGADSLLGTAPARVRPWTPRWGRRGCWPRAGLAFSPSYDGGLHGLQSKI
EDHLDEAIHVLRSHAVGTAGDVHALLPGHGALASGFAGPMPLGGRHAGLAGAGHPEDGLA
GSPSLMHNHAALPSQPGALPDLSRPPDSYSEGEGERGGRADSSISTPEKGPGSRVDSAGD
GSTPEKEELHCCRLSLTSTEEVLSLEEKDLRDRERRMANNARERVRVRDINEAFRELGRM
CQMHLKSDKAQTKLLILQQAVQVILGLEQQVRERNLNPKAACLKRREEEKVSGVVGDPQM
VLSAAHPGLSETHNPTGHM
Download sequence
Identical sequences F7HYY7
ENSCJAP00000008507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]