SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000008765 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000008765
Domain Number 1 Region: 4-115
Classification Level Classification E-value
Superfamily Bromodomain 5.36e-34
Family Bromodomain 0.000000694
Further Details:      
 
Domain Number 2 Region: 997-1052
Classification Level Classification E-value
Superfamily Nuclear receptor coactivator interlocking domain 3.84e-25
Family Nuclear receptor coactivator interlocking domain 0.00026
Further Details:      
 
Domain Number 3 Region: 681-766
Classification Level Classification E-value
Superfamily TAZ domain 8.5e-25
Family TAZ domain 0.0000024
Further Details:      
 
Domain Number 4 Region: 617-663
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000165
Family ZZ domain 0.00016
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000008765
Domain Number - Region: 195-234
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0014
Family PHD domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000008765   Gene: ENSCJAG00000004770   Transcript: ENSCJAT00000009266
Sequence length 1334
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:1:201840799:201862810:1 gene:ENSCJAG00000004770 transcript:ENSCJAT00000009266 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KVFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKSPMDLSTIKRKL
DTGQYQEPWQYVDDIWLMFNNAWLYNRKTSRVYKYCSKLSEVFEQEIDPVMQSLGYCCGR
KLEFSPQTLCCYGKQLCTIPRDATYYSYQNRYHFCEKCFNEIQGESVSLGDDPSQPQTTI
NKEQFSKRKNDTLDPELFVECTECGRKMHQICVLHHEIIWPAGFVCDGCLKKSARTRKEN
KFSAKRLPSTRLGTFLENRVNDFLRRQNHPESGEVTVRVVHASDKTVEVKPGMKARFVDS
GEMAESFPYRTKALFAFEEIDGVDLCFFGMHVQEYGSDCPPPNQRRVYISYLDSVHFFRP
KCLRTAVYHEILIGYLEYVKKLGYTTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEW
YKKMLDKAVSERIVHDYKDIFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEE
RKREENTSNESTDVTKGDSKNAKKKNNKKTSKNKSSLSRGNKKKPGMPNVSNDLSQKLYA
TMEKHKEVFFVIRLIAGPAANSLPPIVDPDPLIPCDLMDGRDAFLTLARDKHLEFSSLRR
AQWSTMCMLVELHTQSQDRFVYTCNECKHHVETRWHCTVCEDYDLCITCYNTKNHDHKME
KLGLGLDDESNNQQAAATQSPGDSRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQ
HTKGCKRKTNGGCPICKQLIALCCYHAKHCQENKCPVPFCLNIKQKLRQQQLQHRLQQAQ
MLRRRMASMQRTGVVGQQQGLPSPTPATPTTPTGQQPTTPQTPQPTSQPQPTPPSSMPPY
LPRTQAAGPVSQGKAAGQVTPPTPPQTAQPPLPGPPPAAVEMAMQIQRAAETQRQMAHVQ
IFQRPIQHQMPPMAPMAPMGMNPPPMTRGPSGHLEPGMGPTGMQQQPPWAQGGLPQPQQL
QSGMPRPAMMSVAQHGQPLNMAPQPGLGQVGVSPLKPGTVSQQALQNLLRTLRSPSSPLQ
QQQVLSILHANPQLLAAFIKQRAAKYANSNPQSLPGQPGMPQGQPGLQPPTMPGQQAVHS
NPAMQNMNPMQAGVQRAGLPQQQPQQQLQPPMGGMSPQAQQMNMNHNAMPSQFRDILRRQ
QMMQQQQQQGAGPGIGPGMANHNQFQQPQGQRPGASLRGLSAGSLQQQMGSPAQPNPMSP
QQHMLPNQAQSPHLQGQQIPNSLSNQVRSPQPVPSPRPQSQPPHSSPSPRMQPQPSPHHV
SPQTSSPHPGLVAAQANPMEQGHFASPEQNSMLSQLTSNPGMANLHGASATDLGLSTDNS
DLNSNLSQSTLDIH
Download sequence
Identical sequences F7HM85
ENSCJAP00000008765

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]