SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000008985 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000008985
Domain Number 1 Region: 48-162
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 6.67e-43
Family Frizzled cysteine-rich domain 0.00000913
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000008985   Gene: ENSCJAG00000004918   Transcript: ENSCJAT00000009491
Sequence length 574
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:6:117629544:117633397:1 gene:ENSCJAG00000004918 transcript:ENSCJAT00000009491 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGPGAAASRSPLGLCALVLTLLGALSAGAGAQPYHGEKGISVPDHGFCQPISIPLCTDI
AYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLDQAIPPC
RSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDGSGGPGGGPTAYP
TAPYLPDLPYTALPPGAADGRGRPAFPFSCPRQLKVPPYLGYRFLGERDCGAPCEPGRAN
GLMYFKEEERRFARLWVGVWSVLCCASTLFTVLTYLVDMRRFSYPERPIIFLSGCYFMVA
VAHVAGFLLEDRAVCVERFSDDGYRTVAQGTKKEGCTILFMVLYFFGMASSIWWVILSLT
WFLAAGMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQVDGDLLSGVCYVGLSSVDA
LRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLEKLMVRIGVFSVLYTV
PATIVLACYFYEQAFREHWERTWLLQTCKSYAVPCPPGHFPPMSPDFTVFMIKYLMTMIV
GITTGFWIWSGKTLQSWRRFYHRLSHSSKGETAV
Download sequence
Identical sequences A0A2K5C0E9 F7I3D1
XP_008997472.2.60252 XP_012301766.1.9421 ENSCJAP00000008985 ENSCJAP00000008985

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]