SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000009155 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000009155
Domain Number 1 Region: 10-117
Classification Level Classification E-value
Superfamily Cgl1923-like 0.000000379
Family Cgl1923-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000009155   Gene: ENSCJAG00000005007   Transcript: ENSCJAT00000009675
Sequence length 258
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:13:43844207:43865502:1 gene:ENSCJAG00000005007 transcript:ENSCJAT00000009675 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLSKLFKMLFQPAVSVGNVGQLAIDLIISTLNMSKIGYFYTDCLVPMVGNNPYATAEGNS
TELSINAEVYSLPSRKLVALQLRSIFIKYKSKPFCEKLLSWVKSSSCARVIVLSSSHSYQ
RNDLQLRSTPFRYLLTPSMQKSVQNKIKSLNWQEMEKSRCIPEIDDSEFCIRIPGGGITK
ALYDESCSKEIQMAVLLKFVSEGDNVPDALGLVEYLNEWLQIIKPPLQSDDPSAATSRWK
IPSSWRLLFGSGLPPALF
Download sequence
Identical sequences F7IQ60
ENSCJAP00000009155 ENSCJAP00000009161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]