SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000009516 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000009516
Domain Number 1 Region: 220-289
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.2e-16
Family HLH, helix-loop-helix DNA-binding domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000009516   Gene: ENSCJAG00000005199   Transcript: ENSCJAT00000010058
Sequence length 314
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:8:84811337:85013957:-1 gene:ENSCJAG00000005199 transcript:ENSCJAT00000010058 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLEALTGLQFQLKEQLGEKERRLQHSQEISTQQTEFHMQFSYKPMFHRLVPARPQIYSSQ
LPSFTKVPAHLESSAQLQKAQREHVNSFMTLDHQIIPTLKRSQPAVPSGGPLVQHAHTAL
DSDAGITENPLTKLLTLGKEDDNAQWHMEDVIEDIIDMESSFKEEGTDSPLLMQRTLSGS
ILDVYSGEQGISPINMGLTSASCPSSLPMKREITETDTRALAKERQKKDNHNLIERRRRY
NINYRIKELGTLIPKSNDPDMRWNKGTILKASVEYIKWLQKEQQRARELEHRQKKLEQAN
RRLLLRIQVFIRML
Download sequence
Identical sequences F7DLZ3
ENSCJAP00000009516

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]