SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000009642 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000009642
Domain Number 1 Region: 13-336,452-498
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.89e-63
Family FAD-linked reductases, N-terminal domain 0.0043
Further Details:      
 
Domain Number 2 Region: 316-439
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.31e-29
Family L-aminoacid/polyamine oxidase 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000009642   Gene: ENSCJAG00000005249   Transcript: ENSCJAT00000010188
Sequence length 511
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:12:121521761:121534757:1 gene:ENSCJAG00000005249 transcript:ENSCJAT00000010188 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESTGGDGKAPGGPRVLVVGSGIAGLGAAQRLCGHPAFPHLRVLEATARAGGRIRSERSF
GGVVEVGAHWIHGPSRGNPVFQLAAEYGLLGEKELSEENQLVETGGHVGLPCVSYTSSGV
RVNLQLVAEMATLFYGLIDQTREFLQAAETPVPSVGEFLRKEIRQHVAGWTEDEETKKLK
LAVLNAFFNLECCVSGTHSMDLVALAPFGEYTVLPGLDCTFSKGYQGLTNCMMASLPEDT
VVFEKPVKTIHWNGAFQEAAFPGETFPVSVECEDGDRFPAHHVIVTVPLGFLKEHLDTFF
DPPLPAEKAEAIRKIGFGTNNKIFLEFEEPFWEPDCQLIQVVWEDTSPLEDPAPALRDAW
FRKLIGFVVLPAFGSVHVLCGFIAGLESEFMETLSDEEVLLCLTQVLQRVTGNPRLPAPK
SVLRSRWHSAPYTRGSYSYVAVGSTGDDLDLLAQPLPADGTDAQLQILFAGEATHRTFYS
TTHGALLSGWREADRLLGLWAPQAQQPRPRL
Download sequence
Identical sequences F7FZ74
ENSCJAP00000009642 XP_002756777.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]