SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000009671 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000009671
Domain Number 1 Region: 52-129
Classification Level Classification E-value
Superfamily Ribosomal protein S18 9.02e-26
Family Ribosomal protein S18 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000009671   Gene: ENSCJAG00000005286   Transcript: ENSCJAT00000010219
Sequence length 144
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:3:110684962:110691340:-1 gene:ENSCJAG00000005286 transcript:ENSCJAT00000010219 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATMVAVCGGLRRKKLTHLVTAAVSLTHPGIHTVLWRRGCSQYKQVASNEDLPIPMENPY
KEPLKKCILCGKRVDYKNVQLLSQFVSPFTGCIYGRHITGLCGKKQKEITKAIKRAQILG
FMPVTYKDPAYLKDPKVCNIRYRE
Download sequence
Identical sequences F7F752
ENSCJAP00000009671 ENSCJAP00000009671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]