SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000009942 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000009942
Domain Number 1 Region: 54-106
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000467
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000009942   Gene: ENSCJAG00000005437   Transcript: ENSCJAT00000010504
Sequence length 153
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:10:57551410:58030930:1 gene:ENSCJAG00000005437 transcript:ENSCJAT00000010504 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRDFANQGDPPWNLRMEGPPPNTSVKGAQRRRSPSALAIEVFEAHLGSHILQSLDGFVFA
LNQEGKFLYISETVSIYLGLSQVELTGSSVFDYVHPGDHVEMAEQLGMKLPPGRGLLSQG
TAEDGASSASSSSQSETPEPVVCFSPASDQFPP
Download sequence
Identical sequences F7HHB2
ENSCJAP00000009942

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]