SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000009970 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000009970
Domain Number 1 Region: 667-782,947-1000
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000000000246
Family FAD/NAD-linked reductases, N-terminal and central domains 0.049
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000009970
Domain Number - Region: 465-571
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.000123
Family N-acetyl transferase, NAT 0.014
Further Details:      
 
Domain Number - Region: 182-248
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.000282
Family N-acetyl transferase, NAT 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000009970   Gene: ENSCJAG00000005444   Transcript: ENSCJAT00000010533
Sequence length 1142
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:5:25660522:25936874:1 gene:ENSCJAG00000005444 transcript:ENSCJAT00000010533 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVLTSPRGKVEVVHCRRTDSQDIYCIKSLIRKFTHKLFGKLNIIYLLEKANLAVTLCND
KEEFMAQATFLDYPNWNVAKQDDWVSVFRELDSDIPCTPLNTLFMHLFVAVDEYSVGCCK
EILRTVYKAVPELHFIFLIVPSYMSLGSTLITVFDQVGIMPCVTYEEDFAVHICHRHSHC
PQLHVRKARVEDHDHLMPIFMRYDTILKETYGEYFLAELIEAQDEENHAVVCEVDGAAVG
FMSVCSRVNMQLLHECFDLGPFHGLCFPHPDDVLESPQELSVRGSQDAELKSSSQSFQKI
VKESKEPVSPDTMENIQGKIAGEAASEEALSVVQNGVSEPEDIEKLSEASPGCAQDHHGS
SRSLASLLQPEEPAHFRPIYRGASAAFCIQLFCIDEKYEARQVLSLDFMNFVFSLFSDKN
FCVISLPRLTPEFILIQNFVKVVPFNTCTVEQDLYVFHRAGLLKSINIRFATLSDTPGVE
NLVSTLMLNKNILEDLAHYNKAHKAPDGTLLQAFVAEVAEQIVGIAVITNEMDVEYLRSH
YNIEEFIYFSHHQREEHGHMHHFALNPIFRHYTKFFLKEILRLGFKSCLYYPVYPTSREG
KFQNPYAHSLTSALHYLVPVRPRRQIVYPLEKLGINAPSKAVSKDLMSYALNHTNRKLTL
EPKITVNARIVVVGASSVGISFLETLVFCSHLKFNNLTLISTHGLPGKKLLDTEQRKFLA
SDHCFNDKDYALMSLCSWVNVVVGRMTGIDRAAKHVVLSTDEIVLYDHLILCTGQQYQVP
CPTGADISQHLTNREVPNSSQRRYTGKVPCNHFTLNEEEDCFKALTWMRNNFITTEGNVI
VYGNTIDTYTTVETILNLGVSGSRIHLVQPPPVSTITCFNNYSVESAVADALRASGVTIY
RDAILAQWNDGLHPDPIYSASFTAPLKSFRLQCSMFFSFCEKKVDYETFKALNDACLVYD
GQLVIDTHFHTNDIAIRAAGSLTKFSNRYYSNEWTHSNFSSKEIGFQLAAAMLHLFDPSL
EPVTEPPADLDRLIPVYKGAKIQGGILPGSYHYLHIAKPAIPTPLETQMAQPDYGLEIVT
SSAENGTYFRIHINKYQMVETITCLSKEPFPTSNYICLFGQHEQLLNNLRARYNENLITD
LY
Download sequence
Identical sequences F7HC74
ENSCJAP00000009970 ENSCJAP00000009935

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]