SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000009978 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000009978
Domain Number 1 Region: 303-392
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.05e-19
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.00057
Further Details:      
 
Domain Number 2 Region: 129-181
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000644
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.027
Further Details:      
 
Domain Number 3 Region: 7-66
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000837
Family HLH, helix-loop-helix DNA-binding domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000009978   Gene: ENSCJAG00000005437   Transcript: ENSCJAT00000010542
Sequence length 903
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:10:57553618:58156191:1 gene:ENSCJAG00000005437 transcript:ENSCJAT00000010542 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLQALRKEKSRDAARSRRGKENFEFYELAKLLPLPAAITSQLDKASIIRLTISYLKMRDF
ANQGDPPWNLRMEGPPPNTSVKGIQMWKSELCMRKTPCEVIGAQRRRSPSALAIEVFEAH
LGSHILQSLDGFVFALNQEGKFLYISETVSIYLGLSQVELTGSSVFDYVHPGDHVEMAEQ
LGMKLPPGRGLLSQGTAEDGASSASSSSQSETPEPVESTSPSLLTTDNALERSFFIRMKS
TLTKRGVHIKSSGYKVIHITGRLRLRVSLSHGRTVPSQIMGLVVVAHALPPPTINEVRID
CHMFVTRVNMDLNIIYCENRISDYMDLTPVDIVGKRCYHFIHAEDVEGIRHSHLDLLNKG
QCVTKYYRWMQKNGGYIWIQSSATIAINAKNANEKNIIWVNYLLSNPEYKDTPMDIAQLP
HLPEKTSESSETSDSESDSKDTSGITEDNENSKSDEKGNQSENSEDPEPDRKKSGNACDN
DMNCNDDGHSSSNPDSRDSDDSFEHSDFENPKAGEDGFGALGPMQIKVERYVESESDLRL
QNCESLTSDSAKDSDSAGEAGAQASSKHQKRKKRRKRQKGGRASRRRLSSASSPGGLDAG
LVEPPRLLSSPNSTSVLKIKTEISEPINFDNDSSIWNYPPNREISRNESPYSMTKPPSSE
HFPSPQGGGGGGGGSGGGLHVAIPDSVLTPPGADGAATRKTQFGASATAALAPVASDPLS
PPLSASPRDKHPGNGGGGGGGSGGSGGPSGSNSLLYTGDLEALQRLQAGNVVLPLVHRVT
GTLAATSTAAQRVYTTGTIRYAPAEVTLAMQSNLLPNAHAVNFVDVNSPGFGLDPKTPME
MLYHHVHRLNMSGPFGGAVSAASLTQMPAGNVFTTAEGLFSTLPFPVYSNGIHAAQTLER
KED
Download sequence
Identical sequences F7HC58
ENSCJAP00000009978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]