SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000010060 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCJAP00000010060
Domain Number - Region: 13-65
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00119
Family Glutathione peroxidase-like 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000010060   Gene: ENSCJAG00000005509   Transcript: ENSCJAT00000010629
Sequence length 109
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:1:69145894:69156066:-1 gene:ENSCJAG00000005509 transcript:ENSCJAT00000010629 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YVEDLARIPKSFLQEANVTLIVIGQSSYHHIESFCKLTGYSHEIYVDPEREIYKRLGMKR
GEEIASSGNNIHFIHRDKNRLDHKPINSVLQLVGVQHVNFTNRPSVIHV
Download sequence
Identical sequences F7BD08
ENSCJAP00000010060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]