SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000010129 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000010129
Domain Number 1 Region: 130-224
Classification Level Classification E-value
Superfamily Immunoglobulin 1.29e-19
Family I set domains 0.0000135
Further Details:      
 
Domain Number 2 Region: 31-136
Classification Level Classification E-value
Superfamily Immunoglobulin 7.9e-19
Family V set domains (antibody variable domain-like) 0.0000156
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000010129   Gene: ENSCJAG00000005522   Transcript: ENSCJAT00000010703
Sequence length 299
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:18:14505730:14533515:-1 gene:ENSCJAG00000005522 transcript:ENSCJAT00000010703 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTKAQAERKLLRLFVLEILLCSLALGSGTVHTSEPEVRIPENNAVKLSCTYSGFSSPRV
EWKFDHGDTTRLVCYNSKITASYENRVTFSSSGITFKSVTREDTGTYTCMVSEEGGNSYG
EVKVKLIVLVPPSKPTVSIPSSATIGNRAVLTCSEQDGSPPSKYTWYRDGIEMPANPKTS
RAFSNSSYNLNPTTGELVFDPVSASDTGEYSCQAENGFGTAVKSNAVRMEAVELNVGAIV
AAVLVTLILLGILIFGIWFAYSRGYFHRAKKGTSSKKVIYSQPSARSEGEFKQTSSFLV
Download sequence
Identical sequences F6YTL1
ENSCJAP00000010120 ENSCJAP00000010129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]