SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000010427 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000010427
Domain Number 1 Region: 7-31
Classification Level Classification E-value
Superfamily SH2 domain 0.000036
Family SH2 domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000010427   Gene: ENSCJAG00000005666   Transcript: ENSCJAT00000011021
Sequence length 34
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:1:71435492:71480790:1 gene:ENSCJAG00000005666 transcript:ENSCJAT00000011021 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSSMADSANHLPFFFGNITREEAEDYLVQGHE
Download sequence
Identical sequences F7HWV5
ENSCJAP00000010427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]