SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000010857 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000010857
Domain Number 1 Region: 12-128
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 7.77e-17
Family Ccg1/TafII250-interacting factor B (Cib) 0.000001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000010857   Gene: ENSCJAG00000005905   Transcript: ENSCJAT00000011467
Sequence length 130
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:15:27715896:27809252:-1 gene:ENSCJAG00000005905 transcript:ENSCJAT00000011467 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSASPPRPGSFLAAVVDALELGPPVVISPSLSGMYSLPFLTAPGSQLRGYVPVAPICTD
KINAANYASVKTPALIVYGDQDPMGQTSFEHLKQLPNHRVLIMKGAGHPCYLDKPEEWHT
GLLDFLQGLE
Download sequence
Identical sequences F7HTK8
ENSCJAP00000010857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]