SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000010911 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000010911
Domain Number 1 Region: 324-545
Classification Level Classification E-value
Superfamily vWA-like 1.75e-51
Family Integrin A (or I) domain 0.00032
Further Details:      
 
Domain Number 2 Region: 162-353
Classification Level Classification E-value
Superfamily vWA-like 4.77e-41
Family Integrin A (or I) domain 0.0013
Further Details:      
 
Domain Number 3 Region: 29-124
Classification Level Classification E-value
Superfamily LCCL domain 3.92e-28
Family LCCL domain 0.00000158
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000010911   Gene: ENSCJAG00000005886   Transcript: ENSCJAT00000011521
Sequence length 552
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:10:55105743:55121475:1 gene:ENSCJAG00000005886 transcript:ENSCJAT00000011521 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAAWIQTLFLGVCLQLLPGPMGSEGAAPIAITCFTRGLDIRKEKADVLCPGGCPLEEFS
VYGNIVYASVSSICGAAVHRGVISNSGGPVRVYSLPGRENYSSVDANGIQSQMLSRWSAS
FTVTKGKSSTQEATGQAVSTAHPPTGKRLKKTPEKKTGNKDCKADIAFLIDGSFNIGQRR
FNLQKNFVGKVALMLGIGTEGPHVGLVQASEHPKIEFYLKNFTSAKDVLFAIKEVGFRGG
NSNTDLGKALKHTAQKFFTVDAGVRKGIPKVVVVFIDGWPSDDIEEAGIVAREFGVNVFI
VSVAKPIPEELGMVQDVSFVDKAVCRNNGFFSYHMPNWFGTTKYVKPLVQKLCTHEQMMC
SKTCYNSVNIAFLIDGSSSVGDSNFRLMLEFVSNIAKTFEISDIGAKIAAVQFTYDQRME
FSFTDYNTKENVLAVIRNIRYMSGGTATGDAISFTVRNVFGPIRESPNKNFLVIVTDGQS
YDDVQGPAAAAHDAGITIFSVGVAWAPLDDLKDMASKPKESHAFFTREFTGLEPIVSDVI
RGICRDFLESQQ
Download sequence
Identical sequences F7IJY6
ENSCJAP00000010911 ENSCJAP00000010849

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]