SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000010929 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000010929
Domain Number 1 Region: 77-269
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.68e-32
Family Ccg1/TafII250-interacting factor B (Cib) 0.0000218
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000010929   Gene: ENSCJAG00000005914   Transcript: ENSCJAT00000011540
Sequence length 271
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:15:27721488:27727407:1 gene:ENSCJAG00000005914 transcript:ENSCJAT00000011540 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIGALCGCWFRLGGARQLFPLSPTVVQTSMSRSQVALLGLGLLLMLLLYVGLPGPLKQTS
WLLGDPNVTVLAGLTPGNSPIFYREVLPLNRARRVQVVLLHGKAFNSHTWEQLGTLQLLS
QRGYRAVALDLPGFGNSASSKEASTEAGRAELLAKALRDLEVQNAVLVSPSLSGRYALPF
LMRGHHQLHGFVPIAPTSTQNYTQEQFWAVKTPTLILYGELDQILARESLRQLRHLPNHS
VVKLHNAGHACYLHKPQDFHVALLAFLDHLP
Download sequence
Identical sequences F7IHQ6
ENSCJAP00000010929 XP_008980011.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]