SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000011751 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000011751
Domain Number 1 Region: 43-143
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.34e-33
Family Thioltransferase 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000011751   Gene: ENSCJAG00000006375   Transcript: ENSCJAT00000012394
Sequence length 157
Comment pep:novel chromosome:C_jacchus3.2.1:10:121155213:121164983:1 gene:ENSCJAG00000006375 transcript:ENSCJAT00000012394 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGSLRRAAAALLRWGRGAGGGGFWVPGVRAAGSGAGGGGSAEQLDALVKKDKVVVFLKG
TPEQPQCGFSNAVVQILRLHGVRDYAAYNVLDDPELRQGIKDYSNWPTIPQVYLNGEFVG
GCDILLQMHQNGDLVEELKKLGIHSALLDEKKDQDSK
Download sequence
Identical sequences F7G0E5
ENSCJAP00000011747 ENSCJAP00000011751 XP_002754322.2.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]