SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000011939 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000011939
Domain Number 1 Region: 202-469
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 3.73e-74
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000642
Further Details:      
 
Domain Number 2 Region: 475-578
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 2.27e-23
Family Anticodon-binding domain of Class II aaRS 0.0011
Further Details:      
 
Domain Number 3 Region: 122-219
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 5.62e-18
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.0076
Further Details:      
 
Domain Number 4 Region: 61-122
Classification Level Classification E-value
Superfamily TGS-like 0.00000000000205
Family TGS domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000011939   Gene: ENSCJAG00000006429   Transcript: ENSCJAT00000012592
Sequence length 588
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:18:4466973:4485529:1 gene:ENSCJAG00000006429 transcript:ENSCJAT00000012592 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLYQRWQQLRLQGLQAYGLHTAVVSTPPHWLAERLGLFEELWAAQVKRLASMAQKEPRT
IKISLPGGQKVDAVAWNTTPYQLARQISSTLADTAVAAQVNGELYDLERPLETDSDLRFL
TFDSPEGKAVFWHSSTHVLGAAAEQFLGAVLCRGPSTENGFYHDFFLGKERTIRGSELPV
LERICQELTAAAQPFRRLEASRDQLHRLFKAEYARRGFFEVKTPTLFSTKLWEQSGHWEH
YQEDMFAVQPPGSDRPASSQSDHSTRHTTDTLALKPMNCPAHCLMFAHRPRSWRELPLRL
ADFGALHRAEASGGLCGLTRLRCFQQDDAHIFCTTDQLEAEIQSCLDFLRSVYAVLGFSF
RLALSTRPSGFLGDPCLWDQAEQVLQQALKEFGEPWDLNSGDGAFYGPKIDVHLHDALGR
PHQCGTIQLDFQLPLRFDLQYKGQAGALERPVLIHRAVLGSVERLLGVLAESCRGKWPLW
LSPFQVVVIPVGTEQEEYARETQQSLQAAGLVCDLDADSRLTLSRRIRRAQLAHYNFQFV
VGQKEQSKSTVNIRTRDNRLLGEWSLPEAVQRLVVLQNTRVPNAEEIF
Download sequence
Identical sequences F7GBQ5
ENSCJAP00000011939

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]