SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000012026 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000012026
Domain Number 1 Region: 1280-1459
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.09e-52
Family DBL homology domain (DH-domain) 0.0000000134
Further Details:      
 
Domain Number 2 Region: 1466-1586
Classification Level Classification E-value
Superfamily PH domain-like 1.62e-34
Family Pleckstrin-homology domain (PH domain) 0.00000222
Further Details:      
 
Domain Number 3 Region: 278-414
Classification Level Classification E-value
Superfamily Spectrin repeat 4.97e-18
Family Spectrin repeat 0.0061
Further Details:      
 
Domain Number 4 Region: 1098-1235
Classification Level Classification E-value
Superfamily Spectrin repeat 9.16e-18
Family Spectrin repeat 0.0069
Further Details:      
 
Domain Number 5 Region: 500-641
Classification Level Classification E-value
Superfamily Spectrin repeat 9.56e-18
Family Spectrin repeat 0.0052
Further Details:      
 
Domain Number 6 Region: 842-1001
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000224
Family Spectrin repeat 0.0033
Further Details:      
 
Domain Number 7 Region: 35-181
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.00000000102
Family CRAL/TRIO domain 0.015
Further Details:      
 
Domain Number 8 Region: 1645-1710
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000201
Family SH3-domain 0.0036
Further Details:      
 
Domain Number 9 Region: 191-309
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000981
Family Spectrin repeat 0.0084
Further Details:      
 
Domain Number 10 Region: 646-766
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000628
Family Spectrin repeat 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000012026   Gene: ENSCJAG00000006440   Transcript: ENSCJAT00000012682
Sequence length 1725
Comment pep:novel chromosome:C_jacchus3.2.1:15:72434414:72945062:-1 gene:ENSCJAG00000006440 transcript:ENSCJAT00000012682 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDRFWDQWYLWYLRLLRLLDRGSFRNDGLKASDVLPILKEKVAFVSGGRDKRGGPILTF
PARSNHDRIRQEDLRKLVTYLASVPSEDVCKRGFTVIIDMRGSKWDLIKPLLKTLQEAFP
AEIHVALIIKPDNFWQKQKTNFGSSKFIFETSMVSVEGLTKLVDPSQLTEEFDGSLDYNH
EEWIELRLSLEEFFNSAVHLLSRLEDLQEMLARKEFPVDVEGSRRLIDEHTQLKKKVLKA
PVEELDREGQRLLQCIRCSDGFSGRNCIPGSADFQSLVPKITSLLDKLHSTRQHLHQMWH
VRKLKLDQCFQLRLFEQDAEKMFDWISHNKELFLQSHTEIGVSYQYALDLQTQHNHFAMN
SMNAYVNINRIMSVASRLSEAGHYATQQIKQISTQLDQEWKSFAAALDERSTILAMSAVF
HQKAEQFLSGVDAWCKMCSEGGLPSEMQDLELAIHHHQTLYEQVTQAYTEVSQDGKALLD
VLQRPLSPGNSESLTATANYSKAVHQVLDVVHEVLHHQRRLESIWQHRKVRLHQRLQLCV
FQQDVQQVLDWIENHGEAFLSKHTGVGKSLHRARALQKRHDDFEEVAQNTYTNADKLLEA
AEQLAQTGECDPEEIYKAARHLEVRIQDFVRRVEQRKLLLDMSVSFHTHTKELWTWMEDL
QKEMLEDVCADSVDAVQELIKQFQQQQTATLDATLNVIKEGEDLIQQLRSAPPSLGEPSE
ARDSAVSNNKTPHTSSISHIESVLQQLDDAQVQMEELFHERKIKLDIFLQLRIFEQYTIE
VTAELDAWNEDLLRQMNDFNTEDLTLAEQRLQRHTERKLAMNNMTFEVIQQGQDLHQYIM
EVQASGIELICEKDIDLAAQVQELLEFLHEKQHELELNAEQTHKRLEQCLQLRHLQAEVK
QVLGWIRNGESMLNASLVNASSLSEAEQLQREHEQFQLAIESLFHATSLQKTHQSALQVQ
QKAEVLLQAGHYDADAIRECAEKVALHWQQLMLKMEDRLKLVNASVAFYKTSEQVCSVLE
SLEQEYRRDEDWCGGRDKLGPAAEIDHVIPLISKHLEQKEAFLKXCTLARRNAEVFLKYI
HRNNVSMPSVASHTRGPEQQVKAILSELLQRENRVLHFWTLKKRRLDQCQQYVVFERSAK
QALDWIQETGEFYLSTHTSAGETTEETQELLKEYGEFRVPAKQTKEKVKLLIQLADSFVE
KGHIHATEIRKWVTTVDKHYRDFSLRMGKYRYSLEKALGVNTEDNKDLELDIIPASLSDR
EVKLRDANHEVNEEKRKSARKKEFIMAELLQTEKAYVRDLHECLETYLWEMTSGVEEIPP
GILNKEHIIFGNIQEIYDFHNNIFLKELEKYEQLPEDVGHCFVTWADKFQMYVTYCKNKP
DSNQLILEHAGTFFDEIQQRHGLANSISSYLIKPVQRITKYQLLLKELLTCCEEGKGELK
DGLEVMLSVPKKANDAMHVSMLEGFDENLDVQGELILQDAFQVWDPKSLIRKGRERHLFL
FEISLVFSKEIKDSTGHTKYVYKNKLLTSELGVTEHVEGDPCKFALWSGRTPSSDNKTVL
KASNIETKQEWIKNIREVIQERIIHLKGALKEPLQLPKTPAKQRNNSKRDGVEDIDSQGD
GSSQPDTISIASRTSQNTVDSDKLSGGCELTVVLQDFSAGHSTELTIQVGQTVELLERPS
ERPGWCLVRTTERSPPLEGLVPSSALCISHSRSSVEMDCFFPLVK
Download sequence
Identical sequences F7H960
ENSCJAP00000012026 ENSCJAP00000011992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]