SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000012370 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000012370
Domain Number 1 Region: 27-137
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.2e-31
Family Spermadhesin, CUB domain 0.00059
Further Details:      
 
Domain Number 2 Region: 239-350
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.88e-26
Family Spermadhesin, CUB domain 0.0015
Further Details:      
 
Domain Number 3 Region: 430-468
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000017
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 4 Region: 144-180
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000367
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 5 Region: 391-429
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000126
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 6 Region: 191-234
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000131
Family LDL receptor-like module 0.0023
Further Details:      
 
Domain Number 7 Region: 354-391
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000072
Family LDL receptor-like module 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000012370   Gene: ENSCJAG00000006679   Transcript: ENSCJAT00000013039
Sequence length 839
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:16:89998617:90096399:1 gene:ENSCJAG00000006679 transcript:ENSCJAT00000013039 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GRRWNTKESPRWRSALLLLFLAGVYACGETPEQIRAPSGIITSPGWPSEYPAKINCSWFI
RANPGEIITISFQDFDIQGSRRCSLDWLTIETFKNIESYRACGSTIPPPYISSQDHIWIR
FHSDDSISRKGFRLAYFSGKSEEPNCACDQFRCGNGKCIPEAWKCNNMDECGDSSDEDIC
AKEANPPTVAAFQPCAYNQFQCLSRFTKVYTCLPESLKCDGNIDCLDLGDEIDCDVPTCG
QWLKYFYGTFNSPNYPDFYPPGSNCTWLIDTGDHRKVILRFTDFKLDGTGYGDYVKIYDG
LEENPHRLLRVLTAFDSHAPLTVVSSSGQIRVHFCADKVNAARGFNATYQVDGFCLPWEI
PCGGNWGCYTEQQRCDGYWHCPNGRDEINCTMCQKEEFPCSRNGVCYPRSDRCNYQNHCP
NGSDEKNCFFCQPGNFHCKNNRCVFESWVCDSQDDCGDGSDEENCPVIVPTRVITAAVIG
SLICGLLLVIALGCTCKLYSLRMFERRSFETQLSRVEAELLRREAPPSYGQLIAQGLIPP
VEDFPVCSPNQASVLENLRLAVRSQLGFTSVRLPMAGRSSNIWNRIFNFARSRHSGSLAL
VSADGDEVVPSQSTNREPERNHSHRSLFSVESDDTDTENERRDTAGASGGVTAPLPQKVP
PTTAVEATVGAGASSSTQSTRGGHADNGRDVTSVEPPSVSPARHQLTSALSRVTQGLRWV
RFTLGRSSSISQNQSPLRQLDNGVSGRDDDDDVEMLIPISDGASDFDVNDCSRPLLDLAS
DQGQGLRQPYSATNPGVRPSNRDGPCEHCGIVHTAQIPDTCLEVTLKNETSDDEALLLC
Download sequence
Identical sequences F7H3A7
ENSCJAP00000012370

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]