SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000012398 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000012398
Domain Number 1 Region: 500-660
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.5e-46
Family DBL homology domain (DH-domain) 0.0000000455
Further Details:      
 
Domain Number 2 Region: 696-834
Classification Level Classification E-value
Superfamily PH domain-like 8.84e-38
Family Pleckstrin-homology domain (PH domain) 0.000000154
Further Details:      
 
Domain Number 3 Region: 197-331
Classification Level Classification E-value
Superfamily Spectrin repeat 5.76e-16
Family Spectrin repeat 0.0037
Further Details:      
 
Domain Number 4 Region: 933-990
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000223
Family SH3-domain 0.0011
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000012398
Domain Number - Region: 23-107
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.000183
Family CRAL/TRIO domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000012398   Gene: ENSCJAG00000006690   Transcript: ENSCJAT00000013070
Sequence length 1030
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:1:28302867:28364655:1 gene:ENSCJAG00000006690 transcript:ENSCJAT00000013070 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLQDAGIGFILLIDRRRDKWTSVKASVLRIAASFPANLQLVLVLRPTGFFQRTLSDIAFK
FNRDDFKMKVPVIMLSSVPDLHGYIDKSQLTEDLGGTLDYCHSRWLCQRTAIESFALMVK
QTAQMLQSFGTELAETELPNDVQSTSSVLCAHMEKKDKAKEDLWLALKEGHNILESLREP
QAEGSEPGVNQDQLDNQATVQRLLAQLNETEAAFDEFWAKHQQKLEQCLQLRHFEQGFRE
VKAVLDTVSQKIATFTDIGNSLHVQHLLRDLASFEERSSVAVERAQALSLDGEQLIENKH
YAVDSIHPKCQELRHLCDQFSAEIARRRGLLSKSLELHHRLETSMKWCDEGIYLLASQPV
DKCQSQDGAEAALQEIEKFLETGTENKIQELSTIYKEYESILNQDLMEHVRKVFQKQASM
EEVFHRRQASLKKLAARQTRPVQPVAPRPEALAKSPCPSPGIRRGSENCSSEGVLRRGPY
RRAKSEMSESRQSRGSAGEEEESLAILRRHVMSELLDTERAYVEELLCVLEGYAAEMDNP
LMAHLLSTGLHSKKDVLFGNMEEIYHFHNRIFLRELENYTACPELVGRCFLERMEDFQIY
EKYCQNKPRSESLWRQCSDCPFFQECQRKLDHKLSLDSYLLKPVQRITKYQLLLKEVLGF
GVNVQGTHLQQECSSDLLSSLSSPGEEAWLGADVSYSGNLGDLGKLLMQGSFSVWTDHKR
GHTKVKELARFKPMQRHLFLHEKAVLFCKKREENGEGYEKAPSYSYKQSLNMAAVGITEN
VKGDAKKFEIWYNAREEVYIVQAPTPEIKAAWVNEIRKVLTSQLQACREASQHRALEQSH
SLPLPAPTSTSPSRGNPRNIKKLEERKTDPLSLEGYGSSAPLSKPPEKGKGWSKTSHSLE
APEDDGGWSSAEEQINSSDAEEDGGVGPKKLVLGKYTVVADHEKGGPDALVVRSGDVVEL
VQEGDEGLWYVRDSTTGKEGWVPASSLSVHLGQSSSAQCLSSSESSPGSAVLSNSSSCSE
GGQAPFNLQA
Download sequence
Identical sequences F7GT38
ENSCJAP00000012398 ENSCJAP00000012398

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]