SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000012567 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000012567
Domain Number 1 Region: 613-713
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000187
Family Spectrin repeat 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000012567   Gene: ENSCJAG00000006788   Transcript: ENSCJAT00000013245
Sequence length 749
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:14:41863358:41888942:-1 gene:ENSCJAG00000006788 transcript:ENSCJAT00000013245 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALGEEKAEVEASEGTGCGEQEVDTPGPMSGEQPPHLEAEGGLISPVWGAEGIPAPACWV
GTDPGSPSRAHQPQARDTSREPIAERPEPAHGSLPPATMGSGNLLLPGERQVEKTKLSAS
KELPQTLSLPRTTAICSGHDADTEDDPSPVDSPQALDLSQQPHGSGLSRLSQWKSVLSPG
STTPQPSSCSVSASSTESSLQGQQEKAEPRGGCLANVSSSLELVVPQEPSSMVGLGRRPQ
WSPQPVFSGGDAPGLSRRHLSFQAEYWACVLPDSLPPSPDRHSPLWNPNKEYEDLLDYTY
PLRPRPQLPKHLDSRVLADPVLQDSGVDLDSFSVSPASTLKSPTNVSPNCPPAEATALPF
SGPREPSLKRWPSGIPQKQGGMGLSSLSQLASTPRAPGSRDASWERREPALRGTKDWLPV
GKHLDTASPHLRTRDRGWPSPRLEREKRTSQSAQRPTCTESRWKSEEEGESDDEYLALPA
RLTQVSSLVSYLDSISTLVTLPTGDTKGRSPLEVSDSDGPTSLPSSSSQSQLPPGAALRG
SGDPEGQNSCFLPSFIRARDSAREGSLGSSQALRVSSGLLKTRPSLPARLDRWPFSDSEA
EGQLPRKGEQGKESLVQCVKTFCCQLEELICWLYNVADVTDHRTTAKSNLTGLKSSLQLY
RQFKKDIDEHQSLTESVLQKGEILLQCLLENTPVLEDVLGRIAKQSGELESHADRLYDSI
LASLDMLAGCTLIPHKKPMAAMEHPCEGV
Download sequence
Identical sequences F7GMI2
XP_008978852.1.60252 ENSCJAP00000012561 ENSCJAP00000012567

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]