SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000012841 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000012841
Domain Number 1 Region: 346-448
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.68e-26
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0016
Further Details:      
 
Domain Number 2 Region: 157-211,238-253,281-299
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.68e-16
Family BphP N-terminal domain-like 0.051
Further Details:      
 
Domain Number 3 Region: 75-158
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000249
Family HLH, helix-loop-helix DNA-binding domain 0.0022
Further Details:      
 
Domain Number 4 Region: 522-685
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 0.00000129
Family Tetraviridae-like VP 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000012841   Gene: ENSCJAG00000006839   Transcript: ENSCJAT00000013534
Sequence length 740
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:18:4786447:4848961:-1 gene:ENSCJAG00000006839 transcript:ENSCJAT00000013534 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSHHWVQPLPLETLDLDFKVEEPLSRGLLSGGQAGLKYLLLAFLRLDFDDDGEGNGKFLR
CDDDQMSNDKERFARENHSEIERRRRNKMTAYITELSDMVPTCSALARKPDKLTILRMAV
SHMKSLRGTGNTSTDGSYKPSFLTDQELKHLILEAADGFLFIVSCETGRVVYVSDSVTPV
LNQPQSEWFGSTLYDQVHPDDVDKLREQLSTSENALTGRILDLKTGTVKKEGQQSSMRMC
MGSRRSFICRMRCGSSTVDPVSVNRLSFVRNRCRNGLGSVKDGEPHFVVVHCTGYIKAWP
PAGVSLPDDDPEAGQGSKFCLVAIGRLQVTSSPNCTDMSNVCQPTEFISRHNIEGIFTFV
DHRCVATVGYQPQDLLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQEW
LWMRTSSFTFQNPYSDEIEYIICTNTNVNPLTYRQQQQQTELDMVPGRDGLASYNHSQVV
QPVTTTGPEHSKPLEKSDGLFAQDRDPRFSEIYHNINADQSKGISSSTVPATQQLFSQGN
TFPPTPRPAENFRNSGLAPPVTIVQPSASAGQMLAQISRHSNPTQGAAPTWTPTTRSGFS
AQVATQATTKARTSQFGMGSFQTPSSFSSMSLPGAPTASPGAAAYPSLTNRGSNFAPETG
QTAGQFQTRTAEGVGVWPQWQGQQPHHRSSSSEQHVQQSSAQQPGQPEVFQEMLSMLGDQ
SNSYNNEEFPDLTMFPPFSE
Download sequence
Identical sequences F6PMB1
ENSCJAP00000012841

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]