SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000012856 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000012856
Domain Number 1 Region: 204-493,602-644
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.22e-67
Family FAD-linked reductases, N-terminal domain 0.00047
Further Details:      
 
Domain Number 2 Region: 478-592
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 7.36e-25
Family L-aminoacid/polyamine oxidase 0.00025
Further Details:      
 
Domain Number 3 Region: 94-200
Classification Level Classification E-value
Superfamily Homeodomain-like 2.6e-20
Family SWIRM domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000012856   Gene: ENSCJAG00000006934   Transcript: ENSCJAT00000013549
Sequence length 645
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:4:10429380:10464828:-1 gene:ENSCJAG00000006934 transcript:ENSCJAT00000013549 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PETSDHCSLPEDLRVLEVSNHWWYSMLILPPLLKDSVAAPLLSAYYPDCVGMSPSCTSTH
RTATTGNASPGKLEHSKAAPSVHVPGMNRYFQPFYQPNECGKALCVRPDVMELDELYEFP
EYSRDPTMYLALRNLILALWYTNCKEALTPQKCIPHIIVRGLVRIRCVQEVERILYFMTR
KGLINTGVLNVGADQYLLPKDYHNKTVIVIGAGPAGLAAARQLHNFGIKVTVLEAKDRIG
GRVWDDKSFKGVTVGRGAQIVNGCINNPMALMCEQLGISMHKLGERCDLIQEGGRITDPT
IDKRMDFHFNALLDVVSEWRKDKTQLQDVPLGEKIEEIYKAFIKESGIQFSELEGQVLQF
HLSNLEYACGSNLHQVRLGFVKARETLLQFAGDHTLLTPGYSVIIEKLAEGLDIRLQSPQ
VQSIDYSGDEAQVTITDGTGYSAQKVLVTVPLALLQKGAIQFNPPLPEKKMKAINSLGAG
IIEKIALQFPYRFWDSKVQGADFFGHVPPSASKRGLFAVFYDMDPQKKHSVLMSVIAGEA
VASVRTLDDKQVLQQCVATLRELFKEQEVPDPTKYFVTRWSTDPWIQMAYSFVKTGGSGE
AYDIIAEEIQGTIFFAGEATNRHFPQTVTGAYLSGVREASKIAAF
Download sequence
Identical sequences F6U7B1
ENSCJAP00000012856

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]