SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000012876 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000012876
Domain Number 1 Region: 98-200
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.2e-26
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0016
Further Details:      
 
Domain Number 2 Region: 305-470
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 0.000000000365
Family Tetraviridae-like VP 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000012876   Gene: ENSCJAG00000006839   Transcript: ENSCJAT00000013569
Sequence length 525
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:18:4786459:4849157:-1 gene:ENSCJAG00000006839 transcript:ENSCJAT00000013569 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRCGSSTVDPVSVNRLSFVRNRCRNGLGSVKDGEPHFVVVHCTGYIKAWPPAGVSLPDDD
PEAGQGSKFCLVAIGRLQAKVTSSPNCTDMSNVCQPTEFISRHNIEGIFTFVDHRCVATV
GYQPQDLLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTSSF
TFQNPYSDEIEYIICTNTNVKNSSQEPRPALSNAVQRPQLGPTANLPLEMGSGQLAPRQQ
QQQTELDMVPGRDGLASYNHSQVVQPVTTTGPEHSKPLEKSDGLFAQDRDPRFSEIYHNI
NADQSKGISSSTVPATQQLFSQGNTFPPTPRPAENFRNSGLAPPVTIVQPSASAGQMLAQ
ISRHSNPTQGAAPTWTPTTRSGFSAQQVATQATTKARTSQFGMGSFQTPSSFSSMSLPGA
PTASPGAAAYPSLTNRGSNFAPETGQTAGQFQTRTAEGVGVWPQWQGQQPHHRSSSSEQH
VQQSSAQQPGQPEVFQEMLSMLGDQSNSYNNEEFPDLTMFPPFSE
Download sequence
Identical sequences F6TL24
ENSCJAP00000012876

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]