SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000013166 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000013166
Domain Number 1 Region: 33-274
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 4.06e-67
Family LplA-like 0.0000107
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000013166   Gene: ENSCJAG00000007099   Transcript: ENSCJAT00000013877
Sequence length 373
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:14:3281593:3287719:1 gene:ENSCJAG00000007099 transcript:ENSCJAT00000013877 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLIPYSMKNCFQLLYNRQVPTAGFKKKVKNGLIIHSVSNDVYQNLAAEDWIHDHMNLEDK
PILFFWRNSPSVVIGRHQNPWQECNLNLIREEGIKLARRRSGGGAVYHDMGNINLTFFTT
KKKYDRMENLKLIVRALNAVQPQLDVQATKRFDLLLDGQFKISGTASKIGRTTAYHHCTL
LCSTDGTFLSSLLKSPYQGIRSNATASIPSLVKNLLEKDPTLTCEVLMNAVAKEYAAYHQ
TDNHIHLINPTDETLFPGINSKAKELQTWEWIYGKTPKFNINTSFNVLYEQSHLNIKVFI
DIKNGRIEICNIEAPDHWLPLEILDKLNSSLVGSKFCPSETTMLTNILLRTCPQDHKLHS
KWNILCEKIKGIM
Download sequence
Identical sequences F6UBC6
ENSCJAP00000013166 XP_008978374.1.60252 XP_008978375.1.60252 ENSCJAP00000013166

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]