SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000013293 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000013293
Domain Number 1 Region: 3-117
Classification Level Classification E-value
Superfamily Chaperone J-domain 2.62e-34
Family Chaperone J-domain 0.0000451
Further Details:      
 
Domain Number 2 Region: 243-330
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 3.01e-23
Family HSP40/DnaJ peptide-binding domain 0.00021
Further Details:      
 
Domain Number 3 Region: 159-241
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 6.93e-17
Family HSP40/DnaJ peptide-binding domain 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000013293   Gene: ENSCJAG00000007150   Transcript: ENSCJAT00000014006
Sequence length 337
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:7:113796080:113808534:1 gene:ENSCJAG00000007150 transcript:ENSCJAT00000014006 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKDYYCILGIEKGASDEDIKKAYRKQALKFHPDKNKSPQAEEKFKEVAEAYEVLSDPKK
REIYDQFGEEGLKGGAGGTDGQGGTFRYTFHGDPHATFAAFFGGSNPFEIFFGRRMGGGR
DSEEMEIDGDPFSAFGFSMNGYPRDRNSVGPSRLKQDPPVIHELRVSLEEIYNGCTKRMK
ISRKRLNADGRSYRSEDKILTIEIKKGWKEGTKITFPREGDETPNSIPADIVFIIKDKDH
PKFKRDGSNIIYTAKISLREALCGCSINVPTLDGRNIPMSVNDIVKPGMRRRIIGYGLPF
PKNPDQRGDLLIEFEVSFPDTISSSSKEVLRKHLPAS
Download sequence
Identical sequences A0A2K6U534 F6W2E8
ENSCJAP00000013293 XP_003921438.1.74449 XP_008999780.1.60252 XP_008999781.1.60252 XP_010345623.1.74449 ENSCJAP00000013293

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]