SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000013417 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000013417
Domain Number 1 Region: 44-110
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000548
Family HkH motif-containing C2H2 finger 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000013417   Gene: ENSCJAG00000007194   Transcript: ENSCJAT00000014135
Sequence length 131
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:2:62130411:62188876:-1 gene:ENSCJAG00000007194 transcript:ENSCJAT00000014135 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEYPAPGTVEAADGGGAGPYNSSKELERQEPDGVRFDRERARRLWEAVSVAQPVGREEVE
HMIEKNQCLFTNTQCKVCCALLISESQKLAHYQSKKHANKVKRYLAVHGMETLKGETKKL
DSDQPCTRIES
Download sequence
Identical sequences F6X6L9
ENSCJAP00000013417

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]