SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000013638 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000013638
Domain Number 1 Region: 6-43
Classification Level Classification E-value
Superfamily CCHHC domain 0.000000000000353
Family CCHHC domain 0.0013
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000013638
Domain Number - Region: 241-285
Classification Level Classification E-value
Superfamily Lysozyme-like 0.0422
Family Phage lysozyme 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000013638   Gene: ENSCJAG00000007286   Transcript: ENSCJAT00000014365
Sequence length 361
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:14:106877811:107095424:1 gene:ENSCJAG00000007286 transcript:ENSCJAT00000014365 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHESVLKCPTPGCTGRGHVNSNRNSHRSLSGCPIAAAEKLAKAQEKHQSCDVSKSSQASD
RVLRPMCFVKQLEIPQYGYRNNVPTTTPRSNLAKELEKYSKTSFEYNSYDNHTYGKRAIA
PKVQTRDISPKGYDDAKRYCKDPSPSSSSSSSYAPSSSSNLSCGGGSSASSTCSKSSFDY
THDMEAAHMAATAILNLSTRCREMPQNLSTKPQDLCATRNPDMEVDENGTLDLSMNKQRP
RDSCCPILTPLEPMSPQQQAVMSNRCFQLGEGDCWDLPVDYTKMKPRRIDEDESKDITPE
DLDPFQEALEERRYPGEVTIPSPKPKYPQCKESKKDLITLSGCPLADKSIRSMLATSSQE
L
Download sequence
Identical sequences F7CCX3
ENSCJAP00000013638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]