SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000013655 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000013655
Domain Number 1 Region: 242-283
Classification Level Classification E-value
Superfamily CCHHC domain 0.00000000000000235
Family CCHHC domain 0.00081
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000013655
Domain Number - Region: 136-186
Classification Level Classification E-value
Superfamily Lysozyme-like 0.0281
Family Phage lysozyme 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000013655   Gene: ENSCJAG00000007286   Transcript: ENSCJAT00000014383
Sequence length 286
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:14:106972736:107095424:1 gene:ENSCJAG00000007286 transcript:ENSCJAT00000014383 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RPMCFVKQLEIPQYGYRNNVPTTTPRSNLAKELEKYSKTSFEYNSYDNHTYGKRAIAPKV
QTRDISPKGYDDGRSFDYTHDMEAAHMAATAILNLSTRCREMPQNLSTKPQDLPSPNPDM
EVDENGTLDLSMNKQRPRDSCCPILTPLEPMSPQQQAVMSNRCFQLGEGDCWDLPVDYTK
MKPRRIDEDESKDITVSVFCPQPEDLDPFQEALEERRYPGEVTIPSPKPKYPQCKESKKD
LITCATPGCDGSGHVTGNYASHRSLSGCPLADKSIRSMLATSSQEL
Download sequence
Identical sequences F7BXT1
ENSCJAP00000013655

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]