SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000013661 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000013661
Domain Number 1 Region: 571-634
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000167
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 2 Region: 499-545
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000824
Family TSP-1 type 1 repeat 0.00067
Further Details:      
 
Domain Number 3 Region: 626-682
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000361
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 4 Region: 26-73
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000144
Family TSP-1 type 1 repeat 0.0022
Further Details:      
 
Domain Number 5 Region: 78-119
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000589
Family LDL receptor-like module 0.0015
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000013661
Domain Number - Region: 451-488
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00725
Family EGF-type module 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000013661   Gene: ENSCJAG00000007321   Transcript: ENSCJAT00000014389
Sequence length 843
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:2:162470036:162542171:-1 gene:ENSCJAG00000007321 transcript:ENSCJAT00000014389 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKAISLLILVGFTGEFQIFSSASSPVNCQWESYAPWSECNGCTKTQTRRRSVAVYAQYGG
QPCIGSAFETQSCKPTRGCPTEEGCGERFRCFSGQCISKLLVCNGDSDCEEDGADEDRCE
DSERRPSCDIDKPPPNIELTGNGYNALTGQFRNRVINTKSFGGQCRKVFSGDGRDFYRLS
GNVLSYTFQVKVNNDFNYEFYNSTWSYVKCTSTEHTSSSKKRSFFRSSSSSSHSYTSHTN
EIHKEKSYQLLVVENTVEVAQFINNNPEFLQLAEPFWKELSHLPSLYDYSAYRRLIDQYG
THYLQSGSLGGEYRVLFYVDSEKFKQKDFGSVEGKNCKSSGWHFLFSSSRHKCKEMEDAL
KSDSGTHSNVMRGDPFVRGGAAGFVSGLSYLELDNPAGNKRRYSSWAESVTNLPQVIKQK
LTPLYELVKDVPCASVKKLYLKRALEEYLDEFDLCHCQPCQNGGLATVEGTHCVCHCKPY
TFGAACEKGVLIGNQAGGVDGGWSCWSSWSPCVQGKKTRSRECNNPPPSEGGRSCIGETT
ESAQCEDEELEHLRLLEPHCFPLSLVPTEYCPSPPALKDGFVQDEGTMFPVGKNVLYTCN
EGYSLIGNPVARCGEDLRWLVGDMRCQKIACVLPVLMDGIQSHPHKPFYAVGEKVTVSCS
GGMSLEGPSAFLCGSSLKWSPEMKNVRCVQKDTPLTQAVPKCQLWEKLQNSRCVCKMPYE
CGSSLDVCAQDERSKRILPLTVCKLHVLHCQGRNYTLTGMDSCTLPASAEKACGACPLWG
KCDAESSKCVCREASECEEEGFSICVEMNGKEQTMSECEVGALRCTGRSISVISIKPCAV
PTQ
Download sequence
Identical sequences F7BGI3
ENSCJAP00000013645 ENSCJAP00000013661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]