SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000013762 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000013762
Domain Number 1 Region: 1-218
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 8.72e-74
Family BAR domain 0.000000033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000013762   Gene: ENSCJAG00000007394   Transcript: ENSCJAT00000014498
Sequence length 287
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:22:4063135:4100791:-1 gene:ENSCJAG00000007394 transcript:ENSCJAT00000014498 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GAEGTKLDDDFKEMEKKVDVTSKAVTEVLARTIEYLQPNPASRAKLTMLNTVSKIRGQVK
NPGYPQSEGLLGECMIRHGKELGESNFGDALLDAGESMKRLAEVKDSLDIEVKQNFIDPL
QNLCEKDLKEIQHHLKKLEGRRLDFDYKKKRQGKIPDEELRQALEKFEESKEVAETSMHN
LLGTDIEQVSQLSALVDAQLDYHRQAVQILDELAEKLKRRMREASSRPKREYKPKPREPF
DLGEPEQSNGGLPCTSAPKITASSSFRSSDKPIRTPSRSMRECPRPA
Download sequence
Identical sequences F6WH48
ENSCJAP00000013762 ENSCJAP00000013762

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]