SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000013905 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000013905
Domain Number 1 Region: 103-134
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000101
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 2 Region: 71-142,507-542
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000022
Family Growth factor receptor domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000013905   Gene: ENSCJAG00000007477   Transcript: ENSCJAT00000014647
Sequence length 561
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:2:164097263:164176114:1 gene:ENSCJAG00000007477 transcript:ENSCJAT00000014647 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSASWSFAVTICILKISIVTADFTPNYGPRPTESSGSISQIDCRMSPWSEWSQCDPCLKQ
MFRSRSIEAFGQYNGRRCTDTVGDRRQCVPTEPCEDAEDDCGNDFKCNTGRCIKRRLLCN
GDNDCGDFSDEDDCEGDPRTPCRDRVVEESELARTAGYGINILGMDPLSTPFDNEFYNGI
CSRDRDGNTLKYYRRPWNVASLMYETKGEKNFRTEHYEEQIEAFKSVIQDKTSSFDARIA
LKFTPTEVKKAEMEVPCVGTCPQSSLHGQGTFRFSYSKNETYQLFLSYSSKKEKMFLHVK
GEVHLGRFVMRNRDVVLTTTFVDDLKALPATYEKGEYFAFLETYGTHYSSSGSLGGLYEL
VYVLDKAAMNRKGVELNDIKRCLGYHLDISLDFSGISVGGGLNKDDCIKRGDGRSVNITS
EQLIDDVISLIRGGTNKYAFELKEKLLRGTLVDVADFVNWASSINDAPVLISQKLSPIYN
LIPVKMNNAHTKKQNLERAIEDYINEFNARKCHSCQNGGTVILIDGKCMCTCPFKFEGDA
CEISKQKIPEELPDLTFPREK
Download sequence
Identical sequences F6XQR8
ENSCJAP00000013905 ENSCJAP00000013905

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]