SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000013916 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000013916
Domain Number 1 Region: 209-315
Classification Level Classification E-value
Superfamily Cyclin-like 9.07e-33
Family Transcription factor IIB (TFIIB), core domain 0.00000165
Further Details:      
 
Domain Number 2 Region: 115-206
Classification Level Classification E-value
Superfamily Cyclin-like 3.03e-27
Family Transcription factor IIB (TFIIB), core domain 0.000009
Further Details:      
 
Domain Number 3 Region: 11-58
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 7.31e-16
Family Transcriptional factor domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000013916   Gene: ENSCJAG00000007469   Transcript: ENSCJAT00000014659
Sequence length 316
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:7:124806939:124841273:-1 gene:ENSCJAG00000007469 transcript:ENSCJAT00000014659 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RAQTGCLDALPRVTCPNHPDAILVEDYRAGDMICPECGLVVGDRVIDVGSEWRTFSNDKA
TKDPSRVGDSQNPLLSDGDLSTMIGKGTGAASFDEFGNSKYQNRRTMSSSDRAMMNAFKE
ITTMADRINLPRNIVDRTNNLFKQVYEQKSLKGRANDAIASACLYIACRQEGVPRTFKEI
CAVSRISKKEIGRCFKLILKALETSVDLITTGDFMSRFCSNLCLPKQVQMAATHIARKAV
ELDLVPGRSPISVAAAAIYMASQASAEKRTQKEIGDIAGVADVTIRQSYRLIYPRAPDLF
PTDFKFDTPVDKLPQL
Download sequence
Identical sequences F6XQ98
ENSCJAP00000013920 ENSCJAP00000013916

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]