SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000013975 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000013975
Domain Number 1 Region: 470-655
Classification Level Classification E-value
Superfamily Fibronectin type III 7.82e-30
Family Fibronectin type III 0.0017
Further Details:      
 
Domain Number 2 Region: 845-1018
Classification Level Classification E-value
Superfamily Fibronectin type III 1.55e-17
Family Fibronectin type III 0.0056
Further Details:      
 
Domain Number 3 Region: 327-365
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000995
Family LDL receptor-like module 0.00092
Further Details:      
 
Domain Number 4 Region: 106-144
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000249
Family LDL receptor-like module 0.00072
Further Details:      
 
Domain Number 5 Region: 65-104
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000471
Family LDL receptor-like module 0.00076
Further Details:      
 
Domain Number 6 Region: 234-270
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000484
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 7 Region: 281-314
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000123
Family LDL receptor-like module 0.00095
Further Details:      
 
Domain Number 8 Region: 149-182
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000144
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 9 Region: 381-418
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000602
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 10 Region: 421-460
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000262
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 11 Region: 661-789
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000206
Family Fibronectin type III 0.007
Further Details:      
 
Domain Number 12 Region: 186-221
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000144
Family LDL receptor-like module 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000013975   Gene: ENSCJAG00000007446   Transcript: ENSCJAT00000014722
Sequence length 1125
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:11:19332118:19386595:1 gene:ENSCJAG00000007446 transcript:ENSCJAT00000014722 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQTSQCSFSPITGCVCRNPLFLESSTLWPPLSLLPNLLPIIASIENGNVGGEPWDEWTGL
LLSREMHQCRSDEYNCSSGMCIRSSWVCDGDNDCRDWSDEANCTAIYHTCEASNFQCRNG
HCIPQRWACDGDTDCQDGSDEDPVNCEKKCNGFRCPNGTCIPSSKHCDGLRDCSDGSDEQ
HCEPLCTHFMDFVCKNRQQCLFHSMVCDGIIQCRDGSDEDATFAGCSQDPEFHKVCDEFG
FQCQNGVCISLIWKCDGMDDCGDYSDEANCENPTEAPNCSRYFQFRCENGHCIPNRWKCD
RENDCGDWSDEKDCGDSHILPFSTPGPSTCLPNYYRCSSGTCVMDTWVCDGYRDCADGSD
EEACPSLANVTAASTPTQLGRCDRFEFECHQPKKCIPNWKRCDGHRDCQDGRDEANCPTH
STLTCMSREFKCEDGEACIVLSERCDGFLDCSDESDEKACSDELTVYKVQNLQWTADFSG
DVTLTWMRPKKMPSASCVYNVYYRVVGESIWKTLETHSNKTNTVLKVLKPDTTYQVKVQV
QCLSKAHNTNDFVTLRTPEGLPDAPRNLQLSLPREAEGAIVGHWAPPIHTHGLIREYIVE
YSRSGSKMWASQRAASNFTEITNLMVNTLYTVRVAAVTSRGIGNWSDSKSITTIKGKVIP
PPDIHIDSYGENYLSFTLTVETDIKVNGYVVNLYWAFDTHKQERRTLNFRGSILSHKVGN
LTAHTSYEISAWAKTDLGDSPLAFEHVMTKGVCPPAPSLKAKAINQTAVECTWTGPRNVV
YGIFYATSFLDLYRNPKSLTTSLHNKTVIVSKDEQYLFLVRVVVPYQGPSSDYVVVKMIP
DSRLPPRHLHVVHMGKTSVVIKWESPYDSPDQDLLYAIAVKDLIRKTDRSYKVKSRNSTV
EYTLNKLEPGGKYHIIVQLGNMSKDSSIKITTVSLSAPDALKIITENDHVLLFWKSLALK
EKHFNESRGYEIHMFDSAMNITAYLGNTTDNFFKISNLKMGHNYTFTVQARCLFGSQICG
EPAILLYDELGSGVDASAMQAARSTDVAAVVVPILFLILLSLGVGFAILYTKHRRLQSSF
TAFANSHYSSRLGSAIFSSGDDLGEDDEDAPMITGFSDDVPMVIA
Download sequence
Identical sequences F6VCB9
ENSCJAP00000013975

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]