SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000014519 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCJAP00000014519
Domain Number - Region: 37-105
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.00136
Family Transglutaminase, two C-terminal domains 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000014519   Gene: ENSCJAG00000007824   Transcript: ENSCJAT00000015309
Sequence length 183
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:18:10009440:10024423:-1 gene:ENSCJAG00000007824 transcript:ENSCJAT00000015309 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLLAFVVLALFAVTQAEEGARLLASKSLLNRYAVEGRDLTLQYNIYNVGSSAALDVELS
DDSFPPEDFGIVSGMLSVKWDRIAPASNVSHTVVLRPLKAGYFNFTSATITYLAQEDGPV
VIGSTSAPGQGGILAQREFDRRFSPHFLDWAAFGVMTLPSIGIPLLLWYSSKRKYDTPKT
KKN
Download sequence
Identical sequences F7IL41
ENSCJAP00000014519 XP_002760044.3.60252 ENSCJAP00000014519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]