SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000014533 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000014533
Domain Number 1 Region: 625-748
Classification Level Classification E-value
Superfamily EF-hand 1.56e-53
Family EF-hand modules in multidomain proteins 0.000000572
Further Details:      
 
Domain Number 2 Region: 750-846
Classification Level Classification E-value
Superfamily EF-hand 1.87e-40
Family EF-hand modules in multidomain proteins 0.00000394
Further Details:      
 
Domain Number 3 Region: 826-914
Classification Level Classification E-value
Superfamily RING/U-box 8.59e-22
Family ZZ domain 0.0092
Further Details:      
 
Domain Number 4 Region: 65-225
Classification Level Classification E-value
Superfamily Spectrin repeat 7.55e-21
Family Spectrin repeat 0.0075
Further Details:      
 
Domain Number 5 Region: 291-418
Classification Level Classification E-value
Superfamily Spectrin repeat 1.74e-17
Family Spectrin repeat 0.005
Further Details:      
 
Domain Number 6 Region: 441-579
Classification Level Classification E-value
Superfamily Spectrin repeat 4.45e-17
Family Spectrin repeat 0.0074
Further Details:      
 
Domain Number 7 Region: 587-624
Classification Level Classification E-value
Superfamily WW domain 0.00000000000994
Family WW domain 0.00012
Further Details:      
 
Domain Number 8 Region: 11-82
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000173
Family Spectrin repeat 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000014533   Gene: ENSCJAG00000007775   Transcript: ENSCJAT00000015325
Sequence length 1243
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:X:29807942:30670327:-1 gene:ENSCJAG00000007775 transcript:ENSCJAT00000015325 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSSLMLEVPALADFNRAWTELTEWLSLLDRVIKSQRVMVGDLEDINEMIIKQKATLQDL
EQRRPQLEELITAAQNLKNKTSNQEARTIITDRIERIQNQWDEVQEHLQNRRQQLNEMLK
DSTQWLEAKEEAEQVLGQARAKLESWKEGPYTIDAIQKKITETKQLAKDLHQWQINVDVA
NDLALKLLRDYSADDTRKVHMITENINASWGSIQKRVSEREAALEETHRLLQQFPLDLEK
FLAWLTEAETTANVLQDATHKERLLEDSKGVKELMKQWQDLQGEIEAHTDIYHNLDENSQ
RILRSLEGSDDAVLLQRRLDNMNFKWSELRKKSLNIRSHLEASSDRWKRLHLSLQELLVW
LQLKDDELSRQAPIGGDFPAVQKQNDVHRAFKRELKTKEPVIMSTLETVRIFLTEQPLEG
LEKLYQEPRELPPEERAQNVTRLLRKQAEEVNTEWEKLNLHSADWQRKIDEALERLQELQ
EATDELDLKLRQAEVIKGSWQPVGDLLIDSLQDHLEKVKALRGEVAPLRDSVGHVNDLAR
QLTTLGIQLSPYNLSTLEDLNTRWKLLQVAVEDRVRQLHEAHRDFGPASQHFLSTSVQGP
WERAISPNKVPYYINHETQTTCWDHPKMTELYQSLADLNNVRFSAYRTAMKLRRLQKALC
LDLLSLSAACDALDQHNLKQNDQPMDILQIINCLTTIYDRLEQEHNNLVNVPLCVDMCLN
WLLNVYDTGRTGRIRVLSFKTGIISLCKAHLEDKYRYLFKQVASSTGFCDQRRLGLLLHD
SIQIPRQLGEVASFGGSNIEPSVRSCFQFANNKPEIEAALFLDWMRLEPQSMVWLPVLHR
VAAAETAKHQAKCNICKECPIIGFRYRSLKHFNYDICQSCFFSGRVAKGHKMHYPMVEYC
TPTTSGEDVRDFAKVLKNKFRTKRYFAKHPRMGYLPVQTVLEGDNMETPVTLINFWPVDS
APASSPQLSHDDTHSRIEHYASRLAEMENSNGSYLNDSISPNESIDDEHLLIQHYCQSLN
QDSPLSQPRSPAQILISLESEERGELERILADLEEENRNLQAEYDRLKQQHEHKGLSPLP
SPPEMMPTSPQSPRDAELIAEAKLLRQHKGRLEARMQILEDHNKQLESQLHRLRQLLEQP
QAEAKVNGTTVSSPSTSLQRSDSSQPMLLRVVGSQTSESMGEEDLLSPPQDSSTGLEEVM
EQLNNSFPSSRGHNVGSLFHMADDLGRAMESLVSVMTDEEGAE
Download sequence
Identical sequences F7IL04
ENSCJAP00000014533 ENSCJAP00000014533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]