SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000014544 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000014544
Domain Number 1 Region: 1-225
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.11e-79
Family Calponin-homology domain, CH-domain 0.000000636
Further Details:      
 
Domain Number 2 Region: 986-1142
Classification Level Classification E-value
Superfamily Spectrin repeat 2.4e-23
Family Spectrin repeat 0.0053
Further Details:      
 
Domain Number 3 Region: 1093-1253
Classification Level Classification E-value
Superfamily Spectrin repeat 7.63e-19
Family Spectrin repeat 0.0065
Further Details:      
 
Domain Number 4 Region: 1203-1357
Classification Level Classification E-value
Superfamily Spectrin repeat 2.4e-18
Family Spectrin repeat 0.0037
Further Details:      
 
Domain Number 5 Region: 326-436
Classification Level Classification E-value
Superfamily Spectrin repeat 3.53e-18
Family Spectrin repeat 0.0029
Further Details:      
 
Domain Number 6 Region: 405-545
Classification Level Classification E-value
Superfamily Spectrin repeat 3.14e-17
Family Spectrin repeat 0.0038
Further Details:      
 
Domain Number 7 Region: 512-650
Classification Level Classification E-value
Superfamily Spectrin repeat 1.83e-16
Family Spectrin repeat 0.0041
Further Details:      
 
Domain Number 8 Region: 1618-1762
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000249
Family Spectrin repeat 0.0065
Further Details:      
 
Domain Number 9 Region: 1509-1630
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000088
Family Spectrin repeat 0.0052
Further Details:      
 
Domain Number 10 Region: 1813-1957
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000178
Family Spectrin repeat 0.0072
Further Details:      
 
Domain Number 11 Region: 2041-2131
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000281
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 12 Region: 766-889
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000432
Family Spectrin repeat 0.015
Further Details:      
 
Domain Number 13 Region: 1418-1545
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000959
Family Spectrin repeat 0.008
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000014544
Domain Number - Region: 906-1002
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000417
Family Spectrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000014544   Gene: ENSCJAG00000033599   Transcript: ENSCJAT00000015336
Sequence length 2136
Comment pep:novel chromosome:C_jacchus3.2.1:X:30987581:31867389:-1 gene:ENSCJAG00000033599 transcript:ENSCJAT00000015336 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EREDVQKKTFTKWINAQFSKFGKQHIENLFSDLQDGRRLLDLLEGLTGQKLPKEKGSTRV
HALNNVNKALRVLQNNNVDLVNIGSTDIVDGNHKLTLGLIWNIILHWQVKNVMKNIMAGL
QQTNSEKILLSWVRQSTRNYPQVNVINFTTSWSDGLALNALIHSHRPDLFDWNSVVSQQS
ATQRLEHAFNIARYQLGIEKLLDPEDVATTYPDKKSILMYITSLFQVLPQQVSIEAIQEV
EMLPRPPKVTKEEHYQLHHQMHYSQQITVSLAQGYERTTSSPKPRFKSYAFTQAAYVATS
DPTRSPFPAQHLEAPEDKSFGSSLMESEVNLDHYQTALEEVLSWLLSAEDTLQAQGEISN
DVEVVKEQFHTHEGYMMDLTAHQGRVGNILRLGSQLIGTGKLSEDEETEVQEQMNLLNSR
WECLRVASMEKQSNLHRVLMDLQNQKLKELNDWLTKTEERTRKMEEEPLGPDLEDLKRQV
QQHKVLQEDLEQEQVRVNSLTHMVVVVDESSGDHATAALEETIKVLGDRWANICRWTEDR
WVLLQDILLKWQRLTEEQCLFSAWLSEKEDAVNKIHTTGFKDQNEMLSSLQKLAVLKADL
EKKKQSMDKLYSLKQDLLSTLKNKSVTKKTEAWLENFARCWDNLVQKLEKSTAQISQAVT
TAQPSLTQTTVMETVTMVTTREQILVKHAQEELPPPPPQKKRQITVDSEIRKRLDVDITE
LHSWITRSEAVLQSPEFAIYRKEGNFSDLKEKVNAIEREKAEKFRKLQDASRSSQALVEQ
MVNEGVNADSIKQASEQLNSRWIEFCQLLSERLNWLEYQNNIITFYNQLQQLEQMTTTAE
NWLKIQPTTPSEPAAIKSQLKICKDEVNRLSALQPQIERLKIQSIALKEKGQGPMFLDAD
FVAFTNHFNQVFSDVQAKEKELQTIFDTLPPTRYQETMSTIRTWIQQSEAKLSIPQVSVT
EYEIMEQRLGELQALQSSLQEQQSGLNYLSTTVKEMSKKAPSEVSRKYQSEFEEIEGRWK
KLSSQLVEHCQKLEEQMSKLRKIQNHIQTLKKWMAEVDVFLKEEWPAIGDSEILKKQLKQ
CRLLVNDIQTIQPSLNSVNEGGKKIKNEAEPEFALRLEAELKELNNQWDHMCQQVYARKE
ALKGGLEKTVSLQKDLSEMHEWMTQAEEEYLERDFEYKTPDELQTAVEEMKRAKEEAQQK
EAKVKLLTESVNSVIAQAPPAAQEALKKELETLTTNYQWLCTRLNGKCKTLEEVWACWHE
LLSYLEKANKWLNEVEFKLKTTENIPGGAEEISEVLNSLENLMQHSEDNPNQIRILAQTL
TDGGVMDELINEELETFNSRWRELHEEAIRRQKLLEQSIQSAQEIEKSLHLIQESLTFID
KQLAAYIADKVDAAQMPQEAQKIQSDLTSHEISLEEMRKHNQGKEAAQRVLSQIDVAQKK
LQDVSMKFRLFQKPANFEQRLQESKMILDEVKTHLPALETKSVEQEVVQSQLNHCVNLYK
SLSEVKSEVEMVIKTGRQIVQKKQTENPKELDERVTALKLHYNELGAKVTERKQQLEKCL
KLSRKMRKEMNVLTEWLAATDTELTKRSAVEGMPSNLNSEVAWGKATQKEIEKQKVHLKS
ITEVGEALKTVLGKKETLVEDKLSLLNSNWIAVTSRAEEWLNLLLEYQKHMETFNQNVDH
ITKWIIQADTLLDESEKKKPQQKEDVLKRLKAELNDIRPKVDSTRDQAANLMANRGDHCR
KLVEPQISELNHRFAAISHRIKTGKASIPLKELEQFNSDIQKLLEPLEAEIQQGVNLKEE
DFNKDMNEDNEGTVKELLQRGDNLQQRITDERKREEIKIKQQLLQTKHNALKGLRSQRRK
KALEISHQWYQYKRQADDLLKCLDDIEKKLASLPEPRDERKVKEIDRELQKKKEELNAVR
RQAEGLSEDGAAMAVEPTQIQLSKRWREIESKFAQFRRLNFAQIHTVREEMMTVMTEDMP
LEISYVPSTYLTEITHVSQALSEVEQLLNASDLCAKDFENLFKQEESLKNIKDTLQQISG
RIDVIHSKKTAALQSAKPVERVKLQEALSQLDFQWEKVNKMYKDRQGRFDRSVEKWRHFH
YDIKIFNQWLTEAEQFLRKTQIPENWEHAKYKWYLK
Download sequence
Identical sequences F7IIR5
ENSCJAP00000014444 ENSCJAP00000014544

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]