SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000014686 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000014686
Domain Number 1 Region: 157-249
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 1.45e-21
Family Carboxypeptidase regulatory domain 0.00029
Further Details:      
 
Domain Number 2 Region: 3-30,57-159
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 4.32e-19
Family Pancreatic carboxypeptidases 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000014686   Gene: ENSCJAG00000007936   Transcript: ENSCJAT00000015491
Sequence length 407
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:8:11621164:11624429:1 gene:ENSCJAG00000007936 transcript:ENSCJAT00000015491 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKNPFVLGANLNGGERLVSYPYDMARTPTEEQLLAAAMAAARGEDEDEVSEAQETPDHA
VFRWLAISFASAHLTLTEPYRGGCQAQDYTGGMGIVNGAKWNPRSGTINDFSYLHTNCLE
LSFYLGCDKFPHESELPREWENNKEALLTFMEQVHRGIKGVVTDEQGIPIANATISVSGI
NHGVKTASGGDYWRILNPGEYRVTAHAEGYTPSAKTCNVDYDIGATQCNFILARSNWKRI
REIMAMNGNRPIPRIDPSRPMTPQQRRLQQRRLQHRLRLRAQMRLRRLNATTTLDPHTVP
TTLPPAPATTLSTTMEPWGVVPPTTAGWEEWETETYTEVVTEFGTEVEPKFETQLEPEFG
TEVEPEFETQLETEFEEEEEEEEEEMATGQAFPFTTVETYTVNFGDF
Download sequence
Identical sequences F7HV02
ENSCJAP00000014686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]