SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000014704 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000014704
Domain Number 1 Region: 470-689,716-817
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.32e-65
Family Pancreatic carboxypeptidases 0.0000055
Further Details:      
 
Domain Number 2 Region: 296-451
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.84e-37
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00019
Further Details:      
 
Domain Number 3 Region: 817-909
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 6.08e-21
Family Carboxypeptidase regulatory domain 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000014704   Gene: ENSCJAG00000007936   Transcript: ENSCJAT00000015512
Sequence length 1056
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:8:11615874:11624335:1 gene:ENSCJAG00000007936 transcript:ENSCJAT00000015512 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VPPEKTKDKGKKGKKDKGPKVPKLSLEGSPKPPKKGKEKPPKATKKPKEKPPKATKKPKE
KPPKATKKPKEKPPKATKKPLSGKSPPTLAPSETLEWPLPSPPSPGPEELPQEGGEPLPN
NWQGPGEEAREHQPEPEEETELPTLDYNDQIEREDYEDFEYVRRQKRPRPPPSRRRRPER
VWPEPPEEKAPAPAPEEKTGRMGGRXLPPLPPDYGDGYVIPNFDDMDYYFGPPPPQKPDA
ERQTDEEKEKLKKPKKEDGSPKEETDKWAVEKGKDHKEPRKGEEVEEEWTPTEKVKCPPI
GMESHRIEDNQIRASSMLRHGLGAQRGRLNMQAGATEDDYYDGAWCAEDDARTQWIEVDT
RRTTRFTGVITQGRDSSILDDFVTFFVGFSNDSQTWVYRSEAASPQTFHGCDKDTPVLSE
LPEPVVARFIRIYPLTWNGSLCMRLEVLGCAVAPVYSYYAQNEVVATDDLDFRHHSYKDM
RQLMKLVNEECPTITRTYSLGKSSRGLKIYAMEISDNPGEHELGEPEFRYTAGIHGNEVL
GRELLLLLMQYLCREYRDGNPRVRSLVQDTRIHLVPSLNPDGYEVAAQMGSEFGNWALGL
WTEEGFDIFEDFPDLNSVLWGAEERKWVPYRVPNNNLPIPERYLSPDATVSTEVRAIIAW
MEKNPFVLGANLNGGERLVSYPYDMARTPTEEQLLAAAMAAARGEDEDEVSEAQETPDHA
VFRWLAISFASAHLTLTEPYRGGCQAQDYTGGMGIVNGAKWNPRSGTINDFSYLHTNCLE
LSFYLGCDKFPHESELPREWENNKEALLTFMEQVHRGIKGVVTDEQGIPIANATISVSGI
NHGVKTASGGDYWRILNPGEYRVTAHAEGYTPSAKTCNVDYDIGATQCNFILARSNWKRI
REIMAMNGNRPIPRIDPSRPMTPQQRRLQQRRLQHRLRLRAQMRLRRLNATTTLDPHTVP
TTLPPAPATTLSTTMEPWGVVPPTTAGWEEWETETYTEVVTEFGTEVEPKFETQLEPEFG
TEVEPEFETQLETEMATGQAFPFTTVETYTVNFGDF
Download sequence
Identical sequences F7IQN0
ENSCJAP00000014704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]